Tap / click on image to see more RealViewsTM
$56.40
per window cling
 

Nudimmud

Qty:
  1. Size: 76.2 cm x 50.8 cm

    Find your size.
  2. Print Process

  3. Shape

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10.16 cm x 10.16 cm (4” x 4”) to a max of 132.08 cm x 182.88 cm (52” x 72”) (or max 182.88 cm x 132.08 cm (72” x 52”) if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Opaque Design: All-over White Underbase

Art is printed on a white sheet of plastic making colours look very dynamic. Please note that the white sheet is opaque and obscures text and art when viewed from the back of the window cling.

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Nudimmud

Nudimmud

A fluffy white bird adorned with soft pink and blue feathers, nestled among silky pink and yellow blossoms on a dreamy pastel green background.

Customer Reviews

3.5 out of 5 stars rating240 Total Reviews
133 total 5-star reviews13 total 4-star reviews11 total 3-star reviews16 total 2-star reviews67 total 1-star reviews
240 Reviews
Reviews for similar products
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous8 May 2026 • Verified Purchase
Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Front of Cling, Window Cling
Absolutely a waste of money!!! Awful!!!! Unusable!!! .
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous8 May 2026 • Verified Purchase
Style: Partial Transparent Design: No Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Absolutely a waste of money!!! Awful!!!! .
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous8 May 2026 • Verified Purchase
Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Front of Cling, Window Cling
Absolutely a waste of money!!! Awful!!!! Unusable!!! .

Tags

fluffy birdcontemporarymodernflowersvintagepastelpinkgreenyellowbohemian

Other Info

Product ID: 256852668622836818
Posted on 29/04/2026, 1:59 PM
Rating: G