Tap / click on image to see more RealViewsTM
$85.05
per wallpaper
 

Pastel Elegant Pink Grey Stripe Floral Wallpaper

Qty:

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish embossed with a canvas texture and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colours to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Pastel Elegant Pink Grey Stripe Floral Wallpaper

Pastel Elegant Pink Grey Stripe Floral Wallpaper

Pink Grey Stripe Floral Wallpaper. Express yourself with some fun Peel and Stick Wallpaper! Our print-on-demand custom wallpaper is here to redefine your space. This product would be perfect for Renters, DIY Enthusiasts, Homeowners, College students, Parents and Interior Designers! Transform spaces with ease and style, offering a seamless blend of functionality and design. For a custom order, do not place this item in your cart. Instead, message me your request. A link to your item will be emailed to you once the item is available. You can use that link to place your order. Please allow up to 24 hours.

Customer Reviews

4.1 out of 5 stars rating9 Total Reviews
6 total 5-star reviews0 total 4-star reviews2 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
9 Reviews
Reviews for similar products
5 out of 5 stars rating
By Awake A.12 April 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
This is my second terrific, custom-designed Zazzle purchase. My custom-designed wallpaper is fabulous!! It arrived super well-packaged, and on time. It is really beautiful and of very high quality. I think this designer is extremely talented. She certainly knows how to follow instructions for a perfect custom design! You would do well to buy anything from Zazzle and, in particular, this designer. Excellent experience!!
from zazzle.com (US)
5 out of 5 stars rating
By Suzanne R.18 September 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
from zazzle.com (US)
5 out of 5 stars rating
By Charles K.15 August 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
from zazzle.com (US)

Tags

Wallpapers
customwallpaperpeelstickwallpaperremovablewallpapertrendydormdecordesignerwallpaperhomedecorfloralwallpapergirlwallpaperpinkgreyfloralstripe
All Products
customwallpaperpeelstickwallpaperremovablewallpapertrendydormdecordesignerwallpaperhomedecorfloralwallpapergirlwallpaperpinkgreyfloralstripe

Other Info

Product ID: 256676495431015237
Posted on 12/08/2024, 10:14 AM
Rating: G