Tap / click on image to see more RealViewsTM
$18.55
per sheet of 20
 

Pastel Pink Monogram Sticker – Custom Design

Qty:
  1. Shape

  2. Format

  3. Size

  4. Paper Type

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Pastel Pink Monogram Sticker – Custom Design

Pastel Pink Monogram Sticker – Custom Design

"Add a touch of elegance to your belongings with this personalised pastel pink monogram sticker. Featuring a soft blush background and a minimalist initial design, this sticker is perfect for customising laptops, notebooks, water bottles, and more. The high-quality vinyl ensures durability, while the adhesive is strong yet removable, making it easy to reposition without leaving residue."

Customer Reviews

4.8 out of 5 stars rating27.1K Total Reviews
23339 total 5-star reviews2205 total 4-star reviews580 total 3-star reviews366 total 2-star reviews568 total 1-star reviews
27,058 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa T.23 November 2020 • Verified Purchase
Zazzle Reviewer Program
Stickers had a glossy finish which gave them a very professional look. The colour is perfect. And they are the exact size of my lip balm lids. Printing is crisp and clear. Will definitely be ordering again.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie O.18 February 2024 • Verified Purchase
Zazzle Reviewer Program
The label is the perfect size , great quality as a label for a glass jar and the product was just as it looked on line and arrived within a very quick timeframe. The design was just perfect tasteful artistic and I have received so many comments from people on the label . A perfect size, colour and font very professional.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alesha T.16 October 2023 • Verified Purchase
Zazzle Reviewer Program
Product arrived well packaged and in timeframe quoted. Great quality. The quality is fantastic and the colours are great.

Tags

personalisedstickermonogramcustominitialpastelpinkminimalistvinyldecal

Other Info

Product ID: 256529118571070265
Posted on 15/04/2025, 1:55 AM
Rating: G