Tap / click on image to see more RealViewsTM
$78.45
per clipboard
 

Pretty Pink Floral Script Monogram Initial Name Clipboard

Qty:
Personalise this template

Other designs from this category

About Clipboard

Sold by

Style: Clipboard

Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

  • Dimensions: 31.75 cm L x 22.86 cm W; thickness: 0.31 cm
  • Designed for letter and A4 sized paper
  • Holds up to 1.27 cm of paper securely
  • Made of ultra-durable acrylic
  • Printed on both sides
  • /!\WARNING: CHOKING HAZARD - small parts.
  • Not for children under 3 yrs.

About This Design

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty, modern and elegant, this trendy clipboard design features a hand painted watercolor floral motif in the corner, with your name and monogram initial in pink and soft grey hand lettered script typography, and is bordered in matching pink. Copyright Anastasia Surridge for Personalised Home Decor, all rights reserved.

Customer Reviews

4.8 out of 5 stars rating391 Total Reviews
352 total 5-star reviews27 total 4-star reviews5 total 3-star reviews6 total 2-star reviews1 total 1-star reviews
391 Reviews
Reviews for similar products
5 out of 5 stars rating
By Patricia t.26 August 2023Verified Purchase
Clipboard
Zazzle Reviewer Program
I just wish it had a extra gloss texture to shine but I love it anyway!!! Thanks so much !!! .
from zazzle.com (US)
5 out of 5 stars rating
By A.4 April 2019Verified Purchase
Clipboard
Zazzle Reviewer Program
I love this clipboard and get many compliments on it. It's heavy duty and makes me happy looking at the vacation pictures! It goes to the gym with me, holding my workouts. Pictures are excellent and site was easy to use.
from zazzle.com (US)
5 out of 5 stars rating
By D N.15 June 2019Verified Purchase
Clipboard
Zazzle Reviewer Program
My main concern when I searched online for custom clip board manufacturers was will the finished be sturdy enough to deal with my work environment. I was also concerned about the finish on the edges. Would they be sharp and unfinished. I've seen some other custom clip boards where the edges of the board looked rough and unfinished. Or the edges where sharp and dangerous to touch. This clip board checks all of those boxes. The image on the board matched the image that was created for it.
from zazzle.com (US)

Tags

Clipboard
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram
All Products
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram

Other Info

Product ID: 256132108931783769
Posted on 20/10/2021, 5:13 PM
Rating: G