Tap / click on image to see more RealViewsTM
$78.45
per clipboard
 

Pretty Pink Floral Script Monogram Initial Name Clipboard

Qty:

    Other designs from this category

    About Clipboard

    Sold by

    Style: Clipboard

    Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

    • Dimensions: 31.75 cm L x 22.86 cm W; thickness: 0.31 cm
    • Designed for letter and A4 sized paper
    • Holds up to 1.27 cm of paper securely
    • Made of ultra-durable acrylic
    • Printed on both sides
    • /!\WARNING: CHOKING HAZARD - small parts.
    • Not for children under 3 yrs.

    About This Design

    Pretty Pink Floral Script Monogram Initial Name Clipboard

    Pretty Pink Floral Script Monogram Initial Name Clipboard

    Pretty, modern and elegant, this trendy clipboard design features a hand painted watercolor floral motif in the corner, with your name and monogram initial in pink and soft grey hand lettered script typography, and is bordered in matching pink. Copyright Anastasia Surridge for Personalised Home Decor, all rights reserved.

    Customer Reviews

    4.8 out of 5 stars rating400 Total Reviews
    358 total 5-star reviews27 total 4-star reviews5 total 3-star reviews7 total 2-star reviews3 total 1-star reviews
    400 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Kaitlyn B.8 January 2026Verified Purchase
    Clipboard
    Absolute masterpiece. Got this clip board as a Christmas gift for my coach and it turned out AMAZING and is dry-erase. Designed it using canvas and adobe and it looked exactly like the picture. It came late although I paid for express shipping because it was around Christmas time. #10000 percent would recommend again. I couldn’t upload a photo of the front but my design is attached without the wording. .
    from zazzle.com (US)
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Patricia t.26 August 2023Verified Purchase
    Clipboard
    Zazzle Reviewer Program
    I just wish it had a extra gloss texture to shine but I love it anyway!!! Thanks so much !!! .
    from zazzle.com (US)
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Julia S.17 March 2026Verified Purchase
    Clipboard
    I love it it is better than I imagined .
    from zazzle.com (US)

    Tags

    Clipboard
    pinkgirlyprettychicscriptelegantinitialnamefloralmonogram
    All Products
    pinkgirlyprettychicscriptelegantinitialnamefloralmonogram

    Other Info

    Product ID: 256132108931783769
    Posted on 20/10/2021, 5:13 PM
    Rating: G