Sell on Zazzle
Tap / click on image to see more RealViewsTM
$66.45
per round throw cushion
 

Purple Shroom Round Cushion

4.7 out of 5 stars rating
203 Total Reviews |
by
Qty:

Other designs from this category

About Round Cushions

Sold by
Round Cushion
Create your own from scratch

Size: Round Throw Cushion 41 x 41 cm

Zazzle cushions now come in even more sizes and shapes! Make a statement without having to say a word when you accent your home with fully customisable cushions from Zazzle. Made from high-quality fabric, these soft cushions look great with your personalised designs, quotes monograms, and photos. The perfect complement to your living room, bedroom, and more!

  • Dimensions: 40.6 cm diameter (flat), 35.5 cm (stuffed)
  • Hidden zipper enclosure; synthetic-filled insert included
  • Made in the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm (16" x 16"). For best results please add 1.9 cm (3/4") bleed..

Fabric: Brushed Polyester

  • 100% brushed polyester is wrinkle free
  • Vibrant colours help designs really pop
  • Heavy cotton-blend-type texture makes fabric soft to the touch
  • High tensile strength fabric make for long lasting quality
  • Inserts are hypoallergenic and filled with a faux down polyester fiber
  • Machine washable, able to retain color and resist shrinkage

About This Design

Purple Shroom Round Cushion

Purple Shroom Round Cushion

Add a touch of whimsical charm to your space with this round pillow featuring a vibrant purple mushroom motif. The soft, plush fabric offers cosy comfort, while the detailed mushroom design brings a playful and mystical vibe to any room. Perfect for adding a pop of colour to your couch, bed or favourite chair, this pillow is both stylish and functional, making it an ideal accent piece for nature and mushroom lovers.
Herbal4love
Artwork designed by
stockbridge, georgia, United States
View their Store

Customer Reviews

4.7 out of 5 stars rating203 Total Reviews
163 total 5-star reviews25 total 4-star reviews7 total 3-star reviews3 total 2-star reviews5 total 1-star reviews
203 Reviews
Reviews for similar products
5 out of 5 stars rating
By H.26 September 2021 • Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
Gorgeous printed named round cushion. Lovely gold swan with pink named cushion. Good quality sized print
5 out of 5 stars rating
By K.14 March 2021 • Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
I love that this product is different. To find a round cushion is not easy and the choices available were amazing! I have a piece of graffiti art and this goes perfect on a chair at my breakfast bar.
5 out of 5 stars rating
By M.11 December 2022 • Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
Excellent quality product. Better than expected!

Tags

Round Cushions
mushroommagicwhimsicalhippyfantasynaturevibrantcosy
All Products
mushroommagicwhimsicalhippyfantasynaturevibrantcosy

Other Info

Product ID: 256060832306113880
Posted on 28/08/2024, 10:16 AM
Rating: G