Tap / click on image to see more RealViewsTM
$13.65
per sticker
 

Raven and Grim Reaper Vinyl Stickers Customise

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Raven and Grim Reaper Vinyl Stickers Customise

Raven and Grim Reaper Vinyl Stickers Customise

Introducing our spooky and spectral vinyl Raven and Grim Reaper Vinyl Stickers, sure to haunt your imagination and elevate your style! With its intricate detailing and captivating presence, these stickers adds a touch of mystery and intrigue to any surface it graces, making it perfect for adorning laptops, notebooks, water bottles, and more. Whether you're a fan of the supernatural or simply appreciate unique artwork, this raven and grim reaper are bound to impress.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
896 total 5-star reviews67 total 4-star reviews27 total 3-star reviews27 total 2-star reviews74 total 1-star reviews
1,091 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker
5 out of 5 stars rating
By D.16 August 2023Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.

Tags

Custom-Cut Vinyl Stickers
ravengrimreapervinylstickersflowerslaptopsnotebookssupernaturalspooky
All Products
ravengrimreapervinylstickersflowerslaptopsnotebookssupernaturalspooky

Other Info

Product ID: 256215666685755943
Posted on 16/04/2024, 10:36 AM
Rating: G