Tap / click on image to see more RealViewsTM
$4.60
per sticker
 

RAVENCLAW™ Crosshatched Emblem

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

RAVENCLAW™ Crosshatched Emblem

RAVENCLAW™ Crosshatched Emblem

HARRY POTTER™ | The Ravenclaw House Lion stylized with crosshatching, geometric shapes, and filigree.

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
886 total 5-star reviews67 total 4-star reviews24 total 3-star reviews20 total 2-star reviews59 total 1-star reviews
1,056 Reviews
5 out of 5 stars rating
By Mary B.14 January 2022Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I put this sticker on my water bottle and it's holding up great. I've put it through the dishwasher twice and it still looks new. Bright colors, clean lines, sticks well, great quality!
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker

Tags

Custom-Cut Vinyl Stickers
harry potterhogwartsschoolwitchcraftwizardrymagickidsravenclaweaglecrosshatch
All Products
harry potterhogwartsschoolwitchcraftwizardrymagickidsravenclaweaglecrosshatch

Other Info

Product ID: 256747414386222694
Posted on 27/10/2020, 11:05 AM
Rating: G 
TM & © WBEI. Harry Potter Publishing Rights © JKR. (s23)