Tap / click on image to see more RealViewsTM
The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Sale Price $3.45.  
Original Price $4.60 per card
You save 25%

Retirement Party Elegant Pink Rose Gold Feminine Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.95
+$0.95
-$0.30

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Retirement Party Elegant Pink Rose Gold Feminine   Invitation

Retirement Party Elegant Pink Rose Gold Feminine Invitation

This elegant pink and rose gold retirement party invitation with a vintage air, recommended for a woman, has an ornate (faux) rose gold foil frame with elegant baroque decorations on a blush pink background. The name is written in an elegant calligraphy. All text can be personalised and has a pink colour similar to the rose gold frame. The vintage, ornate frame is based on an antique French book cover binding, by Georges Mercier (1885-1939) - Madame de Maupin by Teophile Gautier, edition 1911, now in the public domain.

Customer Reviews

4.8 out of 5 stars rating69.2K Total Reviews
61262 total 5-star reviews5657 total 4-star reviews1036 total 3-star reviews490 total 2-star reviews781 total 1-star reviews
69,226 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.16 May 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Love that there is a bit of humour with it. Quality card. Really good, clean print job
5 out of 5 stars rating
By Kelsy J.24 January 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Perfect and beautiful. Printing was fantastic, exactly what I thought it would be
5 out of 5 stars rating
By T.20 October 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Very happy with my order, the invitations are gorgeous. Price was good and delivery was pretty quick. Would definitely recommend this product. 5 Star! Thank you.

Tags

All Products
retirement partyelegantblush pinkrose goldfemininevintagecalligraphyscriptornateantique

Other Info

Product ID: 256290993018250813
Posted on 10/08/2025, 12:56 PM
Rating: G