Tap / click on image to see more RealViewsTM
$45.45
per shirt
 

Riding the Wave to Success T-shirt

Qty:
Basic Dark T-Shirt
-$2.10
+$15.15
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Riding the Wave to Success T-shirt

Riding the Wave to Success T-shirt

This t-shirt design features a line graph that climbs steadily up a mountain peak, reaching the summit. The design is perfect for new trading graphics designers who are looking to show off their skills and determination. The mountain motif represents the challenges and rewards of trading, while the line graph symbolises success.

Customer Reviews

4.7 out of 5 stars rating32K Total Reviews
25052 total 5-star reviews4908 total 4-star reviews1095 total 3-star reviews487 total 2-star reviews448 total 1-star reviews
31,990 Reviews
Reviews for similar products
4 out of 5 stars rating
By Jarrod H.28 May 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Adult S
I found the shirt quality itself to be well made. Unfortunately I found that the image quality of the artwork is low resoultion. So the art and words aren't as clear. I probably wont buy another shirt to be honest, but I'm glad I supported the podcast of which I'm a fan of. I was just hoping that for the price I paid, it would have been of better quality.
5 out of 5 stars rating
By B M.24 December 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult S
Zazzle Reviewer Program
this was good quality and perfect colour. Printing was great although when we all opened our secret santa gifts one of the other mechanics commented whoever got that for him missed out part time after the word mechanic Sorry I don't have any photos
5 out of 5 stars rating
By Anonymous21 November 2024Verified Purchase
Basic Dark T-Shirt, Black, Adult L
The T-Shirt I ordered arrived promptly and in good condition. My partner loved it. Very pleased with this purchase. Fay B.

Tags

T-Shirts
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger
All Products
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger

Other Info

Product ID: 256145644063570158
Posted on 29/03/2024, 11:27 PM
Rating: G