Tap / click on image to see more RealViewsTM
$47.45
per mug
 

Royal Asatru: Norse Battle Beer Stein

Qty:
Stein
-$16.55
-$14.50
-$12.40
-$6.20
-$4.15
+$4.10
Gray/Blue

Other designs from this category

About Mugs

Sold by

Style: Stein

Don't just drink beer, celebrate it with a made-to-order Zazzle beer stein. Our traditional German beer mug features ornate borders at the rim and base and a detailed handle. Honour your beer with the right vessel for the job, or give a stein to the beer lover in your life.

  • Available in 2 colours – white with metallic gold and grey with blue
  • Dimensions:
    • Grey/Blue 650 ml: 7.6 cm diameter x 16.8 cm height
    • White/Gold 590 ml: 7.6 cm diameter x 16.8 cm height
  • Hand wash only
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Royal Asatru: Norse Battle Beer Stein

Royal Asatru: Norse Battle Beer Stein

This noble design features a classic illustration of a battle scene in a Dutch china motif.

Customer Reviews

4.8 out of 5 stars rating672 Total Reviews
564 total 5-star reviews77 total 4-star reviews17 total 3-star reviews6 total 2-star reviews8 total 1-star reviews
672 Reviews
Reviews for similar products
5 out of 5 stars rating
By Shelley M.2 October 2022Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Zazzle Reviewer Program
Arrived in great time...very well made, and pleased with the quality. Better than I had expected, great artwork and color and ceramic feels of high quality...very happy 😊
4 out of 5 stars rating
By L.14 September 2022Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Zazzle Reviewer Program
This was lovely to create my own personal touches to this Beer Stein. I was able to work on it over a period of time so I didn't have to rush. Overall a very good experience thank you. It was fine. I should have chosen a lighter colour for the hears as can not read the lettering too well. Although I think I could see it fine on the screen when creating it.
5 out of 5 stars rating
By SHARLA C.16 November 2021Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Zazzle Reviewer Program
This stein was out of stock for the longest time. I kept checking to see if it was back and low and behold - Eureka! It was back in stock. I am so glad I waited and didn't attempt to try to find something else. The pricing is extremely good as well for a custom, personalized gift! And since I had already uploaded the design, all I had to do was add it to my cart and purchase it. It looks amazing! Better than expected, great quality and just beautiful! I love it and can't wait to give it to my boss for Christmas! Thank you so much, Zazzle. The designer did a great job! The printing is perfect and the colors are on point. Plus, the mug itself is a great quality piece. Beautiful! I love it!
from zazzle.com (US)

Tags

Mugs
asatruheathenvikingheathenrypagangiftsnorsebattleartefacthistoric
All Products
asatruheathenvikingheathenrypagangiftsnorsebattleartefacthistoric

Other Info

Product ID: 168644807982400119
Posted on 20/01/2013, 5:14 AM
Rating: G