Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.Browse real foil products
$9.45
per invitation
 

Rustic Barn Wood Lace Wedding Photo Tri-Fold Invitation

Qty:
Personalise this template
Vertical
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.90
+$0.90
-$0.30

Other designs from this category

About Trifold Letter Fold Invitations

Sold by

Size: 12.7 cm x 17.8 cm

An invitation for every occasion! The tri-fold letter fold design has more space to include all your important details.

  • Dimensions: 12.7 cm x 17.8 cm tri- fold
  • Full CMYK print process
  • Printing on all sides for no additional cost
  • Standard white envelopes included

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.Browse real foil products
Rustic Barn Wood Lace Wedding Photo Tri-Fold Invitation

Rustic Barn Wood Lace Wedding Photo Tri-Fold Invitation

Amaze your guests with this elegant all in one wedding invite featuring beautiful lace on a rustic wood background with detachable RSVP card. Simply add your event details on this easy-to-use template and adorn this card with your favourite photo to make it a one-of-a-kind invitation.

Customer Reviews

4.7 out of 5 stars rating285 Total Reviews
237 total 5-star reviews28 total 4-star reviews6 total 3-star reviews5 total 2-star reviews9 total 1-star reviews
285 Reviews
3 out of 5 stars rating
By E.3 January 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 12.7 cm x 17.8 cm, Paper: NullValue, Envelopes: NullValue
Zazzle Reviewer Program
The paper on this was top quality. The design however left something missing even though I wanted to love it. Image quality was fairly dull in person compared to online.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Nichole R.18 May 2024Verified Purchase
Trifold Letter Fold Invitation, Size: 12.7 cm x 17.8 cm, Paper: NullValue, Envelopes: NullValue
The invitations came out absolutely beautiful. We have received a lot of compliments on them. We were very happy with how they turned out. Overall they were good. There were a few that we cut improperly so I am glad we ordered some extra ones.
from zazzle.com (US)
5 out of 5 stars rating
By JoAnn T.30 June 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 12.7 cm x 17.8 cm, Paper: NullValue, Envelopes: NullValue
Zazzle Reviewer Program
I loved working with Zazzle start to finish. I was able to edit the invitation with the colors and even change some of the layout to create the exact invitation we wanted. We had pictures, added our story, and even used the back for a fun sequence going in for a kiss. When we submitted the purchase they looked over the document, had us correct some things due to a licensing issue, and when all was cleared the process began. Then we had an issue come up that needed us to change the date. Luckily the printing hadn't happened yet so we were able to cancel the order and reissue the card. When we got it we were very impressed! High quality paper and finish, and everything looked great. We would definitely recommend this company and this product! The finished product was amazing! Very high quality!
from zazzle.com (US)

Tags

Trifold Letter Fold Invitations
All Products
barn wedding3 in 1all in oneoutdoorbackyardfarmelegantchicvintagecountry

Other Info

Product ID: 256011811762018066
Posted on 18/01/2021, 8:53 PM
Rating: G