Tap / click on image to see more RealViewsTM
$14.10
per sticker
 

Saigon (Ho Chi Minh City) HCMC Vietnam Holiday

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Saigon (Ho Chi Minh City) HCMC Vietnam Holiday

Saigon (Ho Chi Minh City) HCMC Vietnam Holiday

Saigon (Ho Chi Minh City) HCMC Vietnam panorama souvenir for holiday. Saigon city urban cityscape design with skyline for Vietnam travel. Lifestyle for urban backpackers and Saigon or Ho Chi Minh City travel. Saigon (Ho Chi Minh City) HCMC Vietnam skyline at night. Saigon or Ho Chi Minh City panorama for vacation in Vietnam. Saigon city souvenir for Vietnam and HCMC trip. You can easily customise and personalise the design by enter the name you want.

Customer Reviews

4.7 out of 5 stars rating25 Total Reviews
21 total 5-star reviews3 total 4-star reviews0 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
25 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.16 August 2023Verified Purchase
Small 10.16 cm x10.16 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Although would stick still used 3M stick because been used on outside of the car window with weathering etc...time will tell if it suffers from UV fading. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.
4 out of 5 stars rating
By D.16 August 2023Verified Purchase
Small 10.16 cm x10.16 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I liked how the design turned out. The material is quite thick and strong.... Although it looked okay with the colors, the next lot of stickers I got illustrated that the printing of the colors was improved on the last stickers...these seemed to have spotting of the ink like print from ink jet printer and so the soild colors looked spotted than one solid color....the last ones I just got looked allot better and sharper definition. The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve resolution ink print and adhesion levels.
5 out of 5 stars rating
By Chandler A.23 August 2023Verified Purchase
Small 10.16 cm x10.16 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
saigonho chi minh cityhcmcvietnamnightnighttimeskylinepanoramacityscaperetro
All Products
saigonho chi minh cityhcmcvietnamnightnighttimeskylinepanoramacityscaperetro

Other Info

Product ID: 256911497533636632
Posted on 22/04/2023, 10:33 AM
Rating: G