Sell on Zazzle
Tap / click on image to see more RealViewsTM
$22.25
per sticker
 

Salty Beach Pin-Up Mermaid -Retro Coastal Life Art

4.6 out of 5 stars rating
1056 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Large 20.32 cm x 20.32 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 20.32 cm L x 21.59 cm H
  • Design Area: 20.32 cm L x 20.32 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Salty Beach Pin-Up Mermaid -Retro Coastal Life Art

Salty Beach Pin-Up Mermaid -Retro Coastal Life Art

This salty beach is enjoying some time out of the water and under the sun. The gorgeous vintage inspired pin-up mermaid wears sunglasses and a sassy expression. This cheeky twist on a classic retro wall art poster will make you smile. A fun coastal life sticker that will look great on your cooler, car, water bottle, laptop and more! Different sizes available.
Fun and Pun Design Co
Artwork designed by
Gulf Coast, FL, United States
View their Store

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
886 total 5-star reviews67 total 4-star reviews24 total 3-star reviews20 total 2-star reviews59 total 1-star reviews
1,056 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.3 September 2021 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5 out of 5 stars rating
By Baby C.24 June 2024 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker
5 out of 5 stars rating
By D.16 August 2023 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.

Tags

Custom-Cut Vinyl Stickers
retropin upbeachartcoastalstickergraphicmermaidsaltylife
All Products
retropin upbeachartcoastalstickergraphicmermaidsaltylife

Other Info

Product ID: 256472163046118471
Posted on 15/12/2025, 2:29 PM
Rating: G