Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Sale Price $29.82.  
Original Price $39.75 per pack of 100
You save 25%

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 400 GSM weight
Bright white, semi-gloss finish

+$5.35
+$5.35
+$5.35
+$10.65
+$10.65
+$10.65
+$10.65
+$10.65
+$10.65

Other designs from this category

About Business Cards

Sold by

Size: Mini, 7.6 cm x 2.5 cm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 7.6 cm x 2.5 cm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 400 GSM weight
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating37.8K Total Reviews
31771 total 5-star reviews3771 total 4-star reviews921 total 3-star reviews546 total 2-star reviews787 total 1-star reviews
37,796 Reviews
Reviews for similar products
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: Square, 6.4 cm x 6.4 cm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend
5 out of 5 stars rating
By S M.27 May 2022Verified Purchase
Business Card, Size: Mini, 7.6 cm x 2.5 cm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
Very cute wee cards to attach to my products, customers adore them also. Spot On! Thank you so much
5 out of 5 stars rating
By Vaneasa C.30 January 2023Verified Purchase
Business Card, Size: American, 8.9 cm x 5.1 cm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
Quality and professional looking cards. I love them. The printing is of professional standards. I couldn't have asked for better.

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Posted on 16/12/2017, 11:55 PM
Rating: G