Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
$30.70
per pack of 50
 

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 400 GSM weight
Bright white, semi-gloss finish

+$15.50
+$15.50
+$15.50
+$30.85
+$30.85

Other designs from this category

About Business Cards

Sold by

Size: Mini, 76 mm x 25 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 76 mm x 25 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 400 GSM weight
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating39.4K Total Reviews
32767 total 5-star reviews3830 total 4-star reviews1040 total 3-star reviews669 total 2-star reviews1065 total 1-star reviews
39,371 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous4 February 2026Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Absolutely beautiful. Superior quality to Vistaprint, and the price made it very worth while. .
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend
5 out of 5 stars rating
By S M.27 May 2022Verified Purchase
Business Card, Size: Mini, 76 mm x 25 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
Very cute wee cards to attach to my products, customers adore them also. Spot On! Thank you so much

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Posted on 16/12/2017, 11:55 PM
Rating: G