Tap / click on image to see more RealViewsTM
Sale Price $3.98.  
Original Price $5.30 per card
You save 25%

Simple Black and White Script Save The Date

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30
+$1.15
+$1.15
+$2.75
+$1.15

Other designs from this category

About Flat Save The Date Cards

Sold by

Size: 12.7 cm x 17.8 cm

Hip hip hooray, it's time to spread the good cheer; a date so important you have to save it!

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High-quality, full-colour, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Simple Black and White Script Save The Date

Simple Black and White Script Save The Date

This simple black and white save the date card features a pretty script save the date with a leaf motif, set above your details in an elegant modern text.

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
2032 total 5-star reviews200 total 4-star reviews33 total 3-star reviews15 total 2-star reviews21 total 1-star reviews
2,301 Reviews
Reviews for similar products
5 out of 5 stars rating
By Karyna R.22 February 2023Verified Purchase
Flat Save The Date Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Super easy ordering and fast delivery. Beautiful "Save the date" cards and envelopes. Everyone has commented on the lovely style and quality of both. Gave the perfect impression to our quests. Thank you. Very clear, sharp images. No bleeding or blurring. Very professional and classy design and printing.
5 out of 5 stars rating
By Kristine B.14 October 2022Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
My save the dates arrived and I could not open them fast enough. They were perfect. Got them all sent out and the response from our future guest was just wow. We were getting phone calls and text messages from so many people. Both men and woman. People just loved them. They were better than I expected. High quality. Just love them. I cannot wait to customize the invitations.
from zazzle.com (US)
5 out of 5 stars rating
By A.4 February 2022Verified Purchase
Flat Save The Date Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
It shipped earlier than I thought thank you! I love how they came out, looks so much better in person! The colors came out perfect. I did not get HD but it still came out beautiful! Pictures of the roses came out nice and colors looked exactly like the order, thank you!
from zazzle.com (US)

Tags

Flat Save The Date Cards
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif
All Products
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif

Other Info

Product ID: 256766060584492636
Posted on 5/12/2019, 8:50 AM
Rating: G