Tap / click on image to see more RealViewsTM
$15.45
per window cling
 

Spooky Halloween

by
Qty:
12.7 cm x 12.7 cm
Automatic Opaque Design: White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10cm x 10cm to a max of 132cm x 183cm (or max 183cm x 132cm if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaque while also making colours vivid

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Spooky Halloween

Spooky Halloween

It's Halloween night, pumpkins come alive and turn into monsters, witches, vampires and other unspeakable creatures. A chilling humor will then take over this dark night.

Customer Reviews

There are no reviews for this product yet.Have you purchased this product?

Tags

Window Clings
halloweenpumpkinmonstervampirewitchfrankensteinslimehorrorbreizh korserhumor
All Products
halloweenpumpkinmonstervampirewitchfrankensteinslimehorrorbreizh korserhumor

Other Info

Product ID: 256097738948882868
Posted on 6/10/2024, 8:35 AM
Rating: G