Tap / click on image to see more RealViewsTM
$23.60
$2.95 per paper plate
 

Stylish Father’s Day Watch – Retro Badge Design wi Paper Plate

Qty:
17.78 cm Round Paper Plate
+$0.50
+$0.40
-$0.10

Other designs from this category

About Paper Plates

Sold by

Size and Style: 17.78 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 17.8 cm diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Stylish Father’s Day Watch – Retro Badge Design wi Paper Plate

Stylish Father’s Day Watch – Retro Badge Design wi Paper Plate

Give your dad the gift of style and sentiment with this retro-inspired Father’s Day watch. Designed with a bold circular badge, elegant stars, and a classic moustache motif, this timepiece is both fashionable and meaningful. A perfect accessory to show your appreciation and love — whether it's for Father’s Day or any day that celebrates him

Customer Reviews

4.5 out of 5 stars rating124 Total Reviews
96 total 5-star reviews8 total 4-star reviews8 total 3-star reviews4 total 2-star reviews8 total 1-star reviews
124 Reviews
Reviews for similar products
4 out of 5 stars rating
By Anonymous20 October 2025Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Very happy with the plates.
5 out of 5 stars rating
By Becky K.5 March 2021Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Zazzle Reviewer Program
My Marie Antoinette tea was a success due in part to the beautiful “China” paper plates by Zazzle. The ladies thought they were real! Zazzle is my go-to first whenever planning an event. They were just like the picture showed- deep rich colors
from zazzle.com (US)
5 out of 5 stars rating
By Tamara M.23 June 2015Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
Ordered for the Bridal Shower I threw for a wedding that I am MoH in. Got many compliments and the Bride loved them! Looked great! No problems at all.
from zazzle.com (US)

Tags

Paper Plates
fathergiftstylishdadwatchtimepiecemoustachebadge
All Products
fathergiftstylishdadwatchtimepiecemoustachebadge

Other Info

Product ID: 256149138393324037
Posted on 1/06/2025, 4:04 AM
Rating: G