Tap / click on image to see more RealViewsTM
$71.48
each
 

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Qty:

Other designs from this category

About Towels

Sold by

Style: Bath Towel

Turn your bathroom into your own personal oasis with a custom towel perfect for drying you off in style. Towel set is a great gift for many occasions.

  • Dimensions: 76.2 cm x 152.4 cm
  • Material: front is a polyester blend, back is 100% cotton
  • Sublimation printing allows for vibrant printing designed to last
  • Machine washable, tumble dry on low

About This Design

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

My design features a beautiful tiled, pink flower motif, within a mosaic frame. This is a repeated, symmetrical pattern placed on a soft sage green, background. Adding a personalized name makes a charming gift idea. This item can be given a personalized name, with the design tool. Change the text and font to a style and color of your choice.

Customer Reviews

4.4 out of 5 stars rating535 Total Reviews
409 total 5-star reviews48 total 4-star reviews19 total 3-star reviews22 total 2-star reviews37 total 1-star reviews
535 Reviews
Reviews for similar products
5 out of 5 stars rating
By L.19 December 2022Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
The quality is excellent, would not hesitate to recommend this shop. Awesome selection of towels, enough to please just about anyone!!! The color is perhaps a little lighter than what I thought it would be, but it is tricky to see on screen when you order. I am waiting for another set that this should match to, holding thumbs. No fault of the printing at all if they do not match exactly. I am extremely happy with the product
5 out of 5 stars rating
By Paula H.16 April 2023Verified Purchase
Hand Towel
Zazzle Reviewer Program
Best suited purpose of sweat towel for son’s basketball practice. Easy to read. Colours nice and easy to name.
5 out of 5 stars rating
By Sally H.29 November 2021Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
These are the most beautiful towels I have ever seen. The only thing is - I am too scared to use them. I am worried that the colour will disappear when I wash them! The printing is beautiful as long as the towel fibres are all facing the right way. They look amazing. just looks like the photo above

Tags

Towels
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic
All Products
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic

Other Info

Product ID: 256053667625050057
Posted on 1/02/2024, 3:29 AM
Rating: G