Tap / click on image to see more RealViewsTM
$17.00
per window cling
 

Temple logo window cling

Qty:
Heads-up!
Sorry, this Print Process is temporarily sold out. Please select another Print Process.
12.7 cm x 12.7 cm
Advanced Opaque Design: Manual White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10.16 cm x 10.16 cm (4” x 4”) to a max of 132.08 cm x 182.88 cm (52” x 72”) (or max 182.88 cm x 132.08 cm (72” x 52”) if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Advanced Opaque Design: Manual White Underbase

Advanced mode where vivid white underbase is defined by user

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Temple logo window cling

Temple logo window cling

Show off your Temple pride with this window decal

Customer Reviews

3.6 out of 5 stars rating210 Total Reviews
122 total 5-star reviews12 total 4-star reviews6 total 3-star reviews13 total 2-star reviews57 total 1-star reviews
210 Reviews
Reviews for similar products
5 out of 5 stars rating
By Evgeny P.6 November 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
from zazzle.com (US)
5 out of 5 stars rating
By PCS I.3 October 2025Verified Purchase
Style: Opaque Design: All-over White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Wow these are great. Great quality, great price, and great look ! The "cling" works great, put these up weeks ago and they still are "clung" with no issues whatsoever!! We'll done! A+.
from zazzle.com (US)
1 out of 5 stars rating
By Anonymous6 September 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
This is RIDICULOUS! Extremely poor quality. And to think I had to wait even longer to receive my order because was delayed. Not happy at all with this order.
from zazzle.com (US)

Tags

Window Clings
templeofwitchcrafttemplewitchcraftsticker
All Products
templeofwitchcrafttemplewitchcraftsticker

Other Info

Product ID: 256151361927057237
Posted on 4/02/2024, 11:30 AM
Rating: G