Tap / click on image to see more RealViewsTM
Sale Price $5.03.  
Original Price $6.70 per card
You save 25%

Thank You for Help Vintage Girl & Cat

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.35
Vertical

Other designs from this category

About Folded Thank You Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Be obsessively grateful! Custom thank you cards for small things, big things, and everything in between.

  • Dimensions: 12.7 cm x 17.78 cm (portrait or landscape)
  • Full colour CMYK print process
  • Double-sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Thank You for Help Vintage Girl & Cat

Thank You for Help Vintage Girl & Cat

This sweet illustration of a girl feeding her cat is the perfect way to say thank you for your help. Image is from Graphics Fairy and is in the public domain. Public-Domain-Download-Girl-Cat-GraphicsFairy

Customer Reviews

4.8 out of 5 stars rating3.7K Total Reviews
3294 total 5-star reviews247 total 4-star reviews48 total 3-star reviews26 total 2-star reviews37 total 1-star reviews
3,652 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alicia D.5 April 2025Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Great lovely cards - paper was stunning and looked of value! .
5 out of 5 stars rating
By Anonymous14 February 2025Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Great quality product. Exceeded expectations.
5 out of 5 stars rating
By Natasha J.5 July 2018Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Creator Review
Arrived on time. Print resolution is perfect! Will order more!

Tags

Folded Thank You Cards
thankyouhelpvintagegirlcatfeedingmilksaucerbowl
All Products
thankyouhelpvintagegirlcatfeedingmilksaucerbowl

Other Info

Product ID: 137663167239947182
Posted on 19/05/2015, 5:48 AM
Rating: G