Tap / click on image to see more RealViewsTM
Sale Price $4.69.  
Original Price $6.70 per card
You save 30%

Thank You for Help Vintage Girl & Cat

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.10
+$1.10
-$0.35
Vertical

Other designs from this category

About Folded Thank You Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Be obsessively grateful! Custom thank you cards for small things, big things, and everything in between.

  • Dimensions: 12.7 cm x 17.78 cm (portrait or landscape)
  • Full colour CMYK print process
  • Double-sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Thank You for Help Vintage Girl & Cat

Thank You for Help Vintage Girl & Cat

This sweet illustration of a girl feeding her cat is the perfect way to say thank you for your help. Image is from Graphics Fairy and is in the public domain. Public-Domain-Download-Girl-Cat-GraphicsFairy

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3259 total 5-star reviews247 total 4-star reviews46 total 3-star reviews26 total 2-star reviews32 total 1-star reviews
3,610 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alicia D.5 April 2025Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Great lovely cards - paper was stunning and looked of value! .
5 out of 5 stars rating
By Anonymous14 February 2025Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Great quality product. Exceeded expectations.
5 out of 5 stars rating
By Janine B.12 October 2020Verified Purchase
Folded Thank You Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte
Zazzle Reviewer Program
Fabulous once I got it ! Zazzle team were unfortunately let down by very poor postal system ordered on 20/09/20 and finally arrived 12/10/20 with multiple emails to resolve. The team worked hard at resolving it and answered questions quickly. Looked lovely and quality of card better than expected

Tags

Folded Thank You Cards
thankyouhelpvintagegirlcatfeedingmilksaucerbowl
All Products
thankyouhelpvintagegirlcatfeedingmilksaucerbowl

Other Info

Product ID: 137663167239947182
Posted on 19/05/2015, 5:48 AM
Rating: G