Tap / click on image to see more RealViewsTM
$31.25
per tile
 

The Griffin's Plume Tile

Qty:
15.24 cm x 15.24 cm
Frame and Keepsake Boxes available
Starting from $8.30
Select your accessory options after adding to cart

Other designs from this category

About Tiles

Sold by

Size: 15.24 cm x 15.24 cm

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home décor. Great for holiday, wedding, and office gifts.

  • Dimensions: 15.24cm L x 15.24cm W; Thickness: 0.5cm
  • Weight: 241g.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 15.24cm x 15.24cm. For best results please add 0.3cm bleed

About This Design

The Griffin's Plume Tile

The Griffin's Plume Tile

Close-up shot of an ornate, decorative tile design. The design features a central, fan-like motif with alternating sections of light purple and light orange. This fan is framed by a green border that curves around the top and sides, with decorative swirls at the bottom corners. The border is further embellished with gold accents, particularly at the top and bottom.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
963 total 5-star reviews62 total 4-star reviews19 total 3-star reviews10 total 2-star reviews10 total 1-star reviews
1,064 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By W.27 April 2024Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
10 days delivery from US to New Zealand, couldn't be better. Tiles securely packed and high quality, just what was wanted. Vibrant colours, quality tile.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pradashnee O.17 December 2020Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
My fiancé and I were happy when we received the tile. It’s Peru and was worth paying extra for expressing postage. Good quality and it is exactly like we wanted it. We are very pleased.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Robyn H.22 November 2021Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
Just perfect for my needs. I want to use it in my garden as a little memorial to my Nana whose name was Iris :). Printing is just great :)

Tags

Tiles
artdecoplumeshellpinkgreenwhitevintageceramictile
All Products
artdecoplumeshellpinkgreenwhitevintageceramictile

Other Info

Product ID: 256697075007500530
Posted on 10/10/2025, 10:49 PM
Rating: G