Tap / click on image to see more RealViewsTM
$38.55
per keychain
 

Together Forever Premium Round Keychain

4.6 out of 5 stars rating
5444 Total Reviews
|
by
Qty:
Premium Round
-$17.20
-$21.65
-$17.20
Small (3.7 cm)

Other designs from this category

About Keychains

Sold by

Style: Premium Round Keychain

Keep your keys safe and spectacular with a round keyring from Zazzle. You can customise it with designs, photographs, or text. These keyrings are waterproof and have a UV coating that will protect any image or design you add.

  • Dimensions:
    • Diameter: 3.66 cm
    • Depth: 0.28 cm
    • Weight: 20 g
  • Full-colour, full-bleed printing
  • Silver coloured metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 2.95 cm x 2.95 cm. For best results please add 0.16 cm bleed

About This Design

Together Forever Premium Round Keychain

Together Forever Premium Round Keychain

Celebrate the unbreakable bond of togetherness with our "Together Forever" Premium Round Keychain. This elegant design captures the essence of eternal connection, making it a perfect keepsake for loved ones. Its sleek, polished finish and meaningful motif symbolise the enduring ties that keep us united, no matter the distance.

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4226 total 5-star reviews783 total 4-star reviews217 total 3-star reviews116 total 2-star reviews102 total 1-star reviews
5,444 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kenton W.15 September 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
I Had To Buy Another One Of These Because The One Im Holding Was Not Red I Order Another One Please Make Sure It’s Red Like The Photo Described The 2nd Photo Is The One I Just Order.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mary K.2 May 2023Verified Purchase
Premium Round Keychain, Large (5.397 cm)
Zazzle Reviewer Program
Really nice quality keychain and the size is isrgect! I love the Artist Pika design on this keychain!!! Printing of the design is chest and color is great! Just looking at this design makes me smile! Love my new Artist Pika keychain!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lori A.3 February 2021Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
I upgraded and was happy I did because I love it. It exceeded my expectations. I have TSD so means something to me. Plus the artist that designed it is amazing. she has many products and many designs. I got RSD you could get MS fibro lyme disease etc. You choose the condition she has many to pick from. Printing was 100% accurate and looks like it's a great wuality
from zazzle.com (US)

Tags

Keychains
together foreverunbreakable bondeternal connectionloveunitykeepsakefriendshipgiftmeaningful keychainelegant design
All Products
together foreverunbreakable bondeternal connectionloveunitykeepsakefriendshipgiftmeaningful keychainelegant design

Other Info

Product ID: 256674265158401907
Posted on 29/08/2024, 6:41 PM
Rating: G