Tap / click on image to see more RealViewsTM
$4.60
per sticker
 

Trendy Pig

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Trendy Pig

Trendy Pig

This design features a cute watercolor pig wearing eyeglasses.

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
886 total 5-star reviews67 total 4-star reviews24 total 3-star reviews20 total 2-star reviews59 total 1-star reviews
1,056 Reviews
5 out of 5 stars rating
By Debbie C.4 November 2022Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was very impressed with the cut and colors of the sticker. I put it on my laptop just like the image suggested and it makes me happy every time I see it. I love it! The printing job is beautiful. Very professional. And the cutout is gorgeous. Overall just really very well done. I couldn't be happier.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker

Tags

Custom-Cut Vinyl Stickers
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash
All Products
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash

Other Info

Product ID: 256434994669832216
Posted on 22/04/2019, 8:26 AM
Rating: G