Tap / click on image to see more RealViewsTM
$6.20
per sticker
 

Trendy Pig

Officially Licensed
Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Trendy Pig

Trendy Pig

This design features a cute watercolor pig wearing eyeglasses.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
915 total 5-star reviews69 total 4-star reviews27 total 3-star reviews30 total 2-star reviews89 total 1-star reviews
1,130 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie C.4 November 2022Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was very impressed with the cut and colors of the sticker. I put it on my laptop just like the image suggested and it makes me happy every time I see it. I love it! The printing job is beautiful. Very professional. And the cutout is gorgeous. Overall just really very well done. I couldn't be happier.
from zazzle.com (US)
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5.0 out of 5 stars rating
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker

Tags

Custom-Cut Vinyl Stickers
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash
All Products
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash

Other Info

Product ID: 256434994669832216
Posted on 22/04/2019, 8:26 AM
Rating: G