Tap / click on image to see more RealViewsTM
$132.00
per pair of leggings
 

Tropical Parrot Birds All Over Print Leggings

Qty:

Other designs from this category

About Leggings

Sold by

Style: Leggings

Style and comfort make these the perfect pair of leggings. Custom-made with care; each pair is printed before being sewn, allowing for fun designs on every square inch. These leggings won't lose their shape so get comfy and look cool with your own unique pair.

Due to the cut-and-sew nature of each pair of leggings, designs, and prints may not match up at the seams. We do not recommend designs with words printed on or across the seam as they are hard to match precisely by even the most skilled of dressmakers.

Size & Fit

  • Full length leggings
  • Model is 5'10" (178 cm) and wearing a size S
  • Compression fit due to high spandex content; our leggings hug in all the right places and suit all body types

Fabric & Care

  • Material: Ultra-stretch polyester spandex blend. Legging is 79% polyester, 21% spandex. Capri is 88% polyester, 12% spandex
  • Sturdy, breathable, and stretches to fit your body
  • High spandex composition means compression fit won't lose shape; hugs in all the right places and bounces back after washing
  • Machine wash cold, gentle cycle. Or hand wash. Tumble dry medium heat. Do not bleach
  • Vibrant print won't fade after washing
  • Hand sewn in Canada

About This Design

Tropical Parrot Birds All Over Print Leggings

Tropical Parrot Birds All Over Print Leggings

Awesome collage of vintage botanical fine art of exotic tropical Parrot Birds and habitat Pods, etc., is on these great All Over Print Leggings. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating817 Total Reviews
701 total 5-star reviews86 total 4-star reviews15 total 3-star reviews8 total 2-star reviews7 total 1-star reviews
817 Reviews
Reviews for similar products
4 out of 5 stars rating
By M.28 December 2022Verified Purchase
All-Over-Print Leggings, M
Zazzle Reviewer Program
The product is carefully made and the print is good quality. The fabric really comfy amd stretchy. The only thing is I wish the waist wasn't so small. After 3 kids I still am a medium but not a Barbie.. The fabric feels durable and supportive. I love wearing these leggins from cycling to dancing to casual events. Wonderful with great detail, true to tartan. It only looks stretched on the buttocks.
5 out of 5 stars rating
By Anonymous20 July 2025Verified Purchase
All-Over-Print Leggings, XS
service and time arriving in nz was outstanding i couldn't believe how quickly they arrived thankyou jo.
5 out of 5 stars rating
By Petra A.3 October 2022Verified Purchase
All-Over-Print Leggings, XS
Zazzle Reviewer Program
Had done 3 of these and love all of them! Great quality! Excellent, exactly like i design it on the computer

Tags

Leggings
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds
All Products
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds

Other Info

Product ID: 256579313708620942
Posted on 3/12/2016, 6:47 PM
Rating: G