Tap / click on image to see more RealViewsTM
$7.45
per card
 

Viking Pattern Blue

Qty:
Choose Your Format
Signature Matte
  • 17 pt thickness / 120 lb weight
  • Light white, uncoated matte finish with an eggshell texture
+$1.05
+$1.05
-$0.30

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

The most popular paper choice, Matte’s eggshell texture is soft to the touch with a smooth finish that provides the perfect backdrop for your chosen designs.

  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating7.3K Total Reviews
6733 total 5-star reviews486 total 4-star reviews70 total 3-star reviews27 total 2-star reviews33 total 1-star reviews
7,349 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Top quality product - better than you buy in the shops!
5 out of 5 stars rating
By Anonymous26 November 2024Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Fantastic to be able to customise your cards. Always been really happy with what I have ordered. Michelle.
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Top quality product indeed!

Tags

Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 137887351179637802
Posted on 19/11/2017, 10:04 AM
Rating: G