Tap / click on image to see more RealViewsTM
Sale Price $4.17.  
Original Price $5.55 per card
You save 25%

Viking Pattern Blue

Qty:
Squared
+$0.35
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30
+$1.15
+$1.15
+$2.75
+$1.15

About Flat Cards

Sold by

Size: 8.9 cm x 12.7 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 8.89 cm x 12.7 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.2K Total Reviews
1965 total 5-star reviews155 total 4-star reviews32 total 3-star reviews22 total 2-star reviews66 total 1-star reviews
2,240 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous29 December 2024Verified Purchase
Flat Card, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
My daughter loved the boarding pass surprise and it was so easy to do and was delivered quickly and in time for her 30th birthday .. it was such a neat way of telling her of her trip .. .
5 out of 5 stars rating
By Sally R.19 September 2021Verified Purchase
Flat Card, Size: 20.3 cm x 10.2 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
Probably the most meaningful card I’ve brought would definitely buy it again for other occasions. Printing was amazing
5 out of 5 stars rating
By Tania W.25 May 2021Verified Purchase
Zazzle Reviewer Program
Love it. Highly recommend. A novel way of expressing condolences. Printing was perfect.

Tags

Flat Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256091188921896013
Posted on 17/11/2017, 10:18 PM
Rating: G