Tap / click on image to see more RealViewsTM
$98.25
per banner
 

Viking Pattern Blue Banner

Qty:

Other designs from this category

About Banners

Sold by

Size: 91cm x 152cm Banner

Shout it from the rooftops, say it big and bold - it's time to get the word out! Indoors or out, our banners are here to help you advertise anything, from birthdays to graduation, weddings to anniversaries. We've got thousands of designs for you to browse through, along with 4 different size options.

  • Dimensions: 0.9 m l x 1.5 m w (horizontal) or 1.5 m l x 0.9 m w (vertical)
  • Edge-to-edge, full colour vibrant print for a bold statement
  • Hemmed and thermally welded edges for neat finish
  • Choice of indoor or outdoor banners. Outdoor banners can be bought with metal grommets

Material: Indoor

Lightweight and durable, our 368 g (13 oz) vinyl material is best suited for indoor or short-term outdoor events. This white flexible material comes with an elegant matte finish, and is both fade and tear resistant.

About This Design

Viking Pattern Blue Banner

Viking Pattern Blue Banner

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
2081 total 5-star reviews90 total 4-star reviews35 total 3-star reviews15 total 2-star reviews43 total 1-star reviews
2,264 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.7 January 2024Verified Purchase
Vinyl Banner, 91cm x 152cm, Indoor
Zazzle Reviewer Program
My item was cheap for the price plus the quality was so good even my husband cannot believe it. Highly recommended +++. It was awesome. Quality was good.
5 out of 5 stars rating
By Anonymous6 April 2025Verified Purchase
Vinyl Banner, 91cm x 152cm, Indoor
Excellent Quality Product with quick delivery. Photos very clear.
5 out of 5 stars rating
By F.19 May 2023Verified Purchase
Vinyl Banner, 0.6m x 0.3m, Indoor
Zazzle Reviewer Program
So happy with my Banner, everything with ny experience with Zazzle was excellent. Highly recommend A+++++. Printing came out excellent, very happy 😊

Tags

Banners
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256325634972916561
Posted on 20/11/2017, 11:22 AM
Rating: G