Tap / click on image to see more RealViewsTM
$53.35
per mug
 

Viking Pattern Blue Beer Stein

Qty:
Stein
-$18.60
-$16.25
-$13.95
-$6.95
-$4.65
+$4.65
Gray/Blue

Other designs from this category

About Mugs

Sold by

Style: Stein

Don't just drink beer, celebrate it with a made-to-order Zazzle beer stein. Our traditional German beer mug features ornate borders at the rim and base and a detailed handle. Honour your beer with the right vessel for the job, or give a stein to the beer lover in your life.

  • Available in 2 colours – white with metallic gold and grey with blue
  • Dimensions:
    • Grey/Blue 650 ml: 7.6 cm diameter x 16.8 cm height
    • White/Gold 590 ml: 7.6 cm diameter x 16.8 cm height
  • Hand wash only
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Beer Stein

Viking Pattern Blue Beer Stein

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating673 Total Reviews
565 total 5-star reviews77 total 4-star reviews17 total 3-star reviews6 total 2-star reviews8 total 1-star reviews
673 Reviews
Reviews for similar products
5 out of 5 stars rating
By Shelley M.2 October 2022Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Zazzle Reviewer Program
Arrived in great time...very well made, and pleased with the quality. Better than I had expected, great artwork and color and ceramic feels of high quality...very happy 😊
4 out of 5 stars rating
By L.14 September 2022Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Zazzle Reviewer Program
This was lovely to create my own personal touches to this Beer Stein. I was able to work on it over a period of time so I didn't have to rush. Overall a very good experience thank you. It was fine. I should have chosen a lighter colour for the hears as can not read the lettering too well. Although I think I could see it fine on the screen when creating it.
5 out of 5 stars rating
By Kimball M.26 June 2019Verified Purchase
Stein, Blue/Grey 625 ml / White/Gold 570 ml
Creator Review
My friends enjoyed this present I made for them. Great printing as always!
from zazzle.com (US)

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168214304985240400
Posted on 18/11/2017, 1:05 PM
Rating: G