Tap / click on image to see more RealViewsTM
$40.55
per ornament
 

Viking Pattern Blue Ceramic Tree Decoration

Qty:
Ceramic Heart Ornament
-$6.55
-$6.55
-$6.55
-$8.75
-$8.75
-$8.75
-$2.20
-$2.20
-$2.20
+$10.95
+$10.95

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic tree decoration. Add family photos, images and personal message to both sides of this tree decoration. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 7.6 cm l x 7.1 cm w; Weight: 39 g.
  • Made of white porcelain
  • Full-colour, full-bleed printing
  • Printing on both sides
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 7.6 cm x 7.1 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Viking Pattern Blue Ceramic Tree Decoration

Viking Pattern Blue Ceramic Tree Decoration

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.5K Total Reviews
9432 total 5-star reviews1283 total 4-star reviews371 total 3-star reviews173 total 2-star reviews282 total 1-star reviews
11,541 Reviews
Reviews for similar products
5 out of 5 stars rating
By Teddi B.14 December 2021Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
After seeing the quality and speedy service I ended up ordering two more for the kid’s Christmas trees. Very impressive! Very professionally done!
from zazzle.com (US)
5 out of 5 stars rating
By K.16 January 2021Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
These were amazing. We brought 3 for our 3 boys that passed away and we got their names put on them. The colours were awesome. The print was great.
5 out of 5 stars rating
By Cynthia N.27 December 2022Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
What a beautiful ceramic heart Zazzle produced! It was so easy to incorporate the dong's photo and it was so well appreciated as a Christmas Gift! Hundreds of fonts to chose from and create the perfect gift! I ordered several for different friend's Christmas gifts and they all loved seeing their pet on the ornament! Thank you Zazzle for a sharp looking gift!
from zazzle.com (US)

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Posted on 18/11/2017, 12:03 PM
Rating: G