Tap / click on image to see more RealViewsTM
$128.00
per fleece blanket
 

Viking Pattern Blue Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 154.2 cm (50 in x 60 in)

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.4K Total Reviews
2900 total 5-star reviews327 total 4-star reviews59 total 3-star reviews45 total 2-star reviews23 total 1-star reviews
3,354 Reviews
Reviews for similar products
5 out of 5 stars rating
By N.18 January 2023Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
Quality perfect, absolutely amazing deal, my mother's Xmas gift after loosing her lifelong companion dog, years all around when opening, she will cherish this forever, I highly recommend. Great quality pictures
5 out of 5 stars rating
By J.22 January 2022Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
I was a little nervous to begin with, wondering about how it would turn out. I was delighted with the quality and softness of the Blanket and how well the photos turned out. I was excited to give the gift to my elderly Father. Image quality was better than I expected
5 out of 5 stars rating
By Evelyn M.29 December 2022Verified Purchase
Fleece Blanket, Large 152.4 cm x 203.2 cm
Zazzle Reviewer Program
Kids really loved the blankets. Soft and perfect for a snuggle blanket. Much better than I had expected with just phone photos.

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Posted on 18/11/2017, 12:45 PM
Rating: G