Tap / click on image to see more RealViewsTM
$1.86  per flyer
$46.50 Subtotal
 

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-$0.10

Other designs from this category

About Flyers

Sold by

Size: 8.5" x 11" (21.6 cm x 27.9 cm)

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

Paper Type: Thin Matte Paper

Your flyers, sell sheets and promotions will pop off the page on this glossy, vibrant, 110lb cover-weight paper. Our basic paper contains 50% recycled content.

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating790 Total Reviews
667 total 5-star reviews85 total 4-star reviews19 total 3-star reviews3 total 2-star reviews16 total 1-star reviews
790 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rosangela M.16 July 2019Verified Purchase
Flyer Paper, Size: 8.5" x 11" (21.6 cm x 27.9 cm), Paper: Thin Glossy Paper
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
from zazzle.com (US)
5 out of 5 stars rating
By Anonymous28 June 2022Verified Purchase
Flyer Paper, Size: 8.5" x 11" (21.6 cm x 27.9 cm), Paper: Thin Matte Paper
Zazzle Reviewer Program
color was very clear and vibrant size was more than appropriate. The oroductvwas perfect for my gatheting and big enough to place in 8½x11 frame. t. Printing was very clear and color true
from zazzle.com (US)
5 out of 5 stars rating
By K S.7 August 2025Verified Purchase
Flyer Paper, Size: 8.5" x 11" (21.6 cm x 27.9 cm), Paper: Thin Glossy Paper
I’m so grateful I got this item just in time for my son’s event! I reached out to customer service and they went above and beyond by upgrading my shipping to Premium at no extra cost. The item arrived quickly and was exactly what I hoped for—great quality and perfect for the occasion. Thank you for making this special moment even better!
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Posted on 20/11/2017, 11:48 AM
Rating: G