Tap / click on image to see more RealViewsTM
$1.75  per flyer
$43.75 Subtotal
 

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-$0.10

Other designs from this category

About Flyers

Sold by

Size: 21.6 cm x 27.9 cm (8.5" x 11")

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating850 Total Reviews
705 total 5-star reviews87 total 4-star reviews23 total 3-star reviews9 total 2-star reviews26 total 1-star reviews
850 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rosangela M.16 July 2019Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Glossy Paper
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
from zazzle.com (US)
5 out of 5 stars rating
By Joan S.7 March 2026Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Matte Paper
Creator Review
My first samples of scrapbook paper printed on flyers in bulk quantities. The colors are crisp and vibrant and the paper is excellent quality. The order arrived almost a week early, too. Very pleased with this order. .
from zazzle.com (US)
5 out of 5 stars rating
By Tracy F.22 February 2026Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Glossy Paper
Product is fantastic. Was able to make chip bags out of the high quality flyers. They arrived on time! Easy to use software. Can't wait to order again!
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Posted on 20/11/2017, 11:48 AM
Rating: G