Tap / click on image to see more RealViewsTM
$1.75  per flyer
$43.75 Subtotal
 

Viking Pattern Blue Flyer

Qty:
  1. Size

  2. Paper Type

Other designs from this category

About Flyers

Sold by

Size: 21.6 cm x 27.9 cm (8.5" x 11")

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating883 Total Reviews
720 total 5-star reviews91 total 4-star reviews25 total 3-star reviews11 total 2-star reviews36 total 1-star reviews
883 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tracy F.22 February 2026Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Glossy
Product is fantastic. Was able to make chip bags out of the high quality flyers. They arrived on time! Easy to use software. Can't wait to order again!
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amelia D.1 June 2026Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Glossy
Verrryyyyy Adorable! I absolutely love them. Although, I’m an early bird when it comes to important celebrations, like my 50th birthday. It is way in November but of course I opened them and I must say I’m very impressed and so glad I got them ! Thank you lots : ) .
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rosangela M.16 July 2019Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Glossy
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Posted on 20/11/2017, 11:48 AM
Rating: G