Tap / click on image to see more RealViewsTM
$1.75  per flyer
$43.75 Subtotal
 

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-$0.10

Other designs from this category

About Flyers

Sold by

Size: 21.6 cm x 27.9 cm (8.5" x 11")

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating824 Total Reviews
685 total 5-star reviews87 total 4-star reviews21 total 3-star reviews7 total 2-star reviews24 total 1-star reviews
824 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rosangela M.16 July 2019Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Glossy Paper
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
from zazzle.com (US)
5 out of 5 stars rating
By Anonymous20 November 2025Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Glossy Paper
Ordered these for a celebration of life they turned out amazing ! Great quality ! Had some issues with the shipping but they took care of it right away ! .
from zazzle.com (US)
5 out of 5 stars rating
By Gail C.28 October 2025Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Matte Paper
The flyer looked very professional and everything was printed perfectly! It was printed on high quality paper as well. I was absolutely satisfied with the completed product.
from zazzle.com (US)

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Posted on 20/11/2017, 11:48 AM
Rating: G