Tap / click on image to see more RealViewsTM
$58.00
per flask
 

Viking Pattern Blue Hip Flask

Qty:
177 ml

Other designs from this category

About Flask

Sold by

Size: Vinyl Wrapped Flask, 177 ml

Be prepared and discreet with a custom Liquid Courage™ flask. A unique gift that's perfect for weddings, birthdays, and special occasions!

  • Dimensions: 9.5 cm (L) x 11.4 cm (W) x 2.5 cm (D); 177 ml
  • Material: Stainless steel flask with attached screw-top lid
  • Printed on high-quality vinyl that is securely wrapped
  • Durable, water and fade resistant
  • Hand wash with warm water
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 9.4 cm x 21.1 cm. For best results, please add 1.1 cm bleed.

About This Design

Viking Pattern Blue Hip Flask

Viking Pattern Blue Hip Flask

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating390 Total Reviews
335 total 5-star reviews46 total 4-star reviews5 total 3-star reviews3 total 2-star reviews1 total 1-star reviews
390 Reviews
Reviews for similar products
5 out of 5 stars rating
By Toni :.16 May 2022Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
Arrived fairly fast considering the current delays. I am very happy with my personalized purchase. The printing looks so cool I was a bit worried at first thinking it would be raised but it is exactly what I wanted.
4 out of 5 stars rating
By T.15 October 2015Verified Purchase
Vinyl Wrapped Flask
Creator Review
Well made flask, a little better than I had expected. Flask came in clear plastic box which gave it a nice presentation when I took it out of the zazzle packaging. Image is not printed on flask but on sticker. Don't know how this will hold up I haven't used it yet. This would make a Great gift! I plan to purchase more for friends! Cheers. I thought a little brighter than computer. Very crisp, writing wasn't really Black Black. It might have been the font though, her leopard dolman sleeve top has black and it was perfect.
from zazzle.com (US)
5 out of 5 stars rating
By MK C.18 December 2014Verified Purchase
Vinyl Wrapped Flask
Creator Review
This flask is my favorite Zazzle order this Christmas. It turned out beautifully and looks like real vintage snake oil. The printed is perfect. The design is centered exactly on the flask the way it should be and it's very vibrant.
from zazzle.com (US)

Tags

Flask
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256200989444562947
Posted on 18/11/2017, 12:57 PM
Rating: G