Tap / click on image to see more RealViewsTM
$93.00
per clock
 

Viking Pattern Blue Large Clock

Qty:
27.3 cm Round Acrylic
-$10.70
-$21.15
-$21.15
-$21.15

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.3 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

Viking Pattern Blue Large Clock

Viking Pattern Blue Large Clock

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.4K Total Reviews
2830 total 5-star reviews384 total 4-star reviews76 total 3-star reviews41 total 2-star reviews60 total 1-star reviews
3,391 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rachel H.14 September 2020Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Thank you so much for this beautiful wall-clock. It was exactly designed the way I wanted and the finishing touches are amazing too. Beyond satisfied with the printing, colour and design.
5 out of 5 stars rating
By Shirley K.2 May 2022Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
It's absolutely beautiful, exactly what was shown Thankyou. So happy with the printing and the colors, can't wait to give to my husband for our 20th wedding anniversary.
5 out of 5 stars rating
By karen B.9 October 2021Verified Purchase
Wall Clock, 25.4 cm Round Black Wooden Frame
Zazzle Reviewer Program
Works well.look lovely great delivery time unique art love ut karen brown. Great item beautiful to look at and works well

Tags

Wall Clocks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256435204405317048
Posted on 18/11/2017, 11:36 AM
Rating: G