Tap / click on image to see more RealViewsTM
$25.45
per tag
 

Viking Pattern Blue Luggage Tag

Qty:

Other designs from this category

About Luggage Tags

Sold by

Style: Double-sided

Stand out in a crowd at the baggage carousel with a custom luggage tag from Zazzle! Sturdy and weatherproof, this luggage tag is ready to stand up to the travel demands of any road warrior or adventure seeker. Printed using the AcryliPrint®HD printing process, your baggage tag shows designs, text, and photos in vibrant clarity and brilliant colors. Customise it with your information and escape bag mix-ups for years to come!

  • Dimensions: 5.1 cm l x 8.9 cm w (standard business card size)
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
  • Leather luggage strap included
  • Printed on both sides
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Luggage Tag

Viking Pattern Blue Luggage Tag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating4.4K Total Reviews
4022 total 5-star reviews291 total 4-star reviews75 total 3-star reviews19 total 2-star reviews28 total 1-star reviews
4,435 Reviews
Reviews for similar products
5 out of 5 stars rating
By Dipti N.19 January 2023Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
Absolutely love it! It was awesome! Perfect
5 out of 5 stars rating
By Anonymous30 July 2024Verified Purchase
Acrylic Luggage Tag
Product was excellent quality - much better than I expected. Can't wait to travel with my new suitcase tags. Very good print quality - happy with the result.
5 out of 5 stars rating
By Debbie G.29 November 2022Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
These look great and are also really solid and robust to withstand the rough and tumble of baggage handling. Very happy with the printing - nice typeface and easy to read.

Tags

Luggage Tags
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256722126263163913
Posted on 28/07/2017, 10:01 PM
Rating: G