Tap / click on image to see more RealViewsTM
$85.90
per set of 50 napkins
 

Viking Pattern Blue Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Coined Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 cm w (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Viking Pattern Blue Napkin

Viking Pattern Blue Napkin

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2587 total 5-star reviews236 total 4-star reviews78 total 3-star reviews56 total 2-star reviews108 total 1-star reviews
3,065 Reviews
Reviews for similar products
5 out of 5 stars rating
By 5.20 October 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
The napkins exceeded my expectations. Good size product and excellent quality. They will be a wonderful addition to the decorations for our 50th wedding anniversary . The product arrived very quickly and beautifully packaged. Beautifully clear printing. Exactly as ordered.
5 out of 5 stars rating
By Sandra R.19 August 2025Verified Purchase
Paper Napkins, Standard Cocktail
Excellent detail. The party concept was barbershop conversations. Napkins were half folded, placed along other objects. Will I reorder again, surely will be. Next concept, I can't tell you.🙂 Thanks .
from zazzle.com (US)
3 out of 5 stars rating
By s.16 September 2019Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Nice napkin albeit could have been slightly larger. Printing design and quality - good

Tags

Paper Napkins
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256214417618707333
Posted on 18/11/2017, 4:46 PM
Rating: G