Tap / click on image to see more RealViewsTM
$39.40
per spiral notebook
 

Viking Pattern Blue Notebook

Qty:
21.59 cm x 27.94 cm Deluxe Spiral Notebook
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 21.59 cm x 27.94 cm Deluxe Spiral Notebook

Accessorise while you organise with these hand made spiral notebooks. The front and back covers are customisable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colours and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 21.6 cm l x 28 cm w
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colours for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

Viking Pattern Blue Notebook

Viking Pattern Blue Notebook

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating779 Total Reviews
707 total 5-star reviews53 total 4-star reviews6 total 3-star reviews3 total 2-star reviews10 total 1-star reviews
779 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.13 November 2022Verified Purchase
21.59 cm x 21.59 cm Deluxe Spiral Notebook, Grey spiral, Wide Ruled pages
Zazzle Reviewer Program
It is PERFECT, absolutely love it. Lovely quality for the price, can't complain at all! The printing came out perfect, and looks beautiful.
5 out of 5 stars rating
By s c.4 September 2020Verified Purchase
21.59 cm x 27.94 cm Deluxe Spiral Notebook, Black spiral, Wide Ruled pages
Zazzle Reviewer Program
This was beyond my expectations it arrived alot sooner then I expected and was amazing and well worth the money. My boyfriend loved it. The printing was great the colour was bright and it popped on the page
1 out of 5 stars rating
By Penelope B.2 January 2025Verified Purchase
21.59 cm x 27.94 cm Deluxe Spiral Notebook, Black spiral, Wide Ruled pages
It is cardboard and plastic /laminated when it clearly states leather. I was expecting a leather front page. .

Tags

Spiral Notebooks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256901698435672199
Posted on 19/11/2017, 10:12 AM
Rating: G