Tap / click on image to see more RealViewsTM
$36.80
$4.60 per paper plate
 

Viking Pattern Blue Paper Plate

Qty:
17.78 cm Round Paper Plate
+$0.25
+$0.25

Other designs from this category

About Paper Plates

Sold by

Size and Style: 17.78 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 17.8 cm diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Viking Pattern Blue Paper Plate

Viking Pattern Blue Paper Plate

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating1.4K Total Reviews
1103 total 5-star reviews102 total 4-star reviews46 total 3-star reviews42 total 2-star reviews70 total 1-star reviews
1,363 Reviews
Reviews for similar products
4 out of 5 stars rating
By Anonymous20 October 2025Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Very happy with the plates.
4 out of 5 stars rating
By Orianne M.24 August 2021Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
I really liked that the design I created was exactly what I received. The plates are of good quality. I am not sure how long they last while in use but I would be fairly confident that they are good. However, it is a pricey piece for a single use item. exceptional, exactly what I expected
5 out of 5 stars rating
By Stacey S.18 March 2026Verified Purchase
Paper Plates, 22.86 cm Square Paper Plate
The watercolor and design are beautiful!!! Excellent Service .
from zazzle.com (US)

Tags

Paper Plates
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256625107117526098
Posted on 18/11/2017, 11:39 AM
Rating: G