Tap / click on image to see more RealViewsTM
$22.85
per pad
 

Viking Pattern Blue Post-it Notes

Qty:
10.2 x 7.6 cm
+$14.40
-$2.85
+$40.15

Other designs from this category

About Post-it® Notes

Sold by

Size: Post-it® Notes 10.2 cm x 7.6 cm (4" x 3")

When your mind is brimming with to-dos, keep it together with a pad of custom 3M Post-it® Notes. Jot down urgent memos, lists, or a sweet note to special someone such as, "Do NOT forget the milk!" Each 10.1 cm x 7.6 cm pad comes with 50 sticky notes printed in full colour with your graphics, text, or photos. If Post-it® Notes are going to be on your desk anyway, they might as well be creatively personal.

  • Authentic 3M Post-it® Notes
  • Dimensions: 10.1 cm x 7.6 cm (Adhesive side: 10.1 cm edge)
  • Printed in full colour on 50-sheet white Post-it® Notes paper
  • Buy in bulk and save
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.1 cm x 7.1 cm. For best results please add 0.15 cm (.12") bleed..

About This Design

Viking Pattern Blue Post-it Notes

Viking Pattern Blue Post-it Notes

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating1.9K Total Reviews
1648 total 5-star reviews173 total 4-star reviews32 total 3-star reviews9 total 2-star reviews14 total 1-star reviews
1,876 Reviews
Reviews for similar products
4 out of 5 stars rating
By Jo H.24 July 2019Verified Purchase
Post-It® Notes, 10.2 x 15.2 cm
Zazzle Reviewer Program
I was very pleased with the product. On this particular one, the light grey has a pinky/magenta tone to it. The darker the black the better though. So I would have to be careful with light gradient in the future. Not sure whether they are printed CMYK or RGB.
5 out of 5 stars rating
By Toni W.20 June 2021Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
Super cute design and the personalisation makes it special. The colours and detail turned out crisp and clear. If I ordered this again, I would choose a darker colour for the text.
5 out of 5 stars rating
By Jo H.24 July 2019Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
Meets all my requirements. Text could be sharper.

Tags

Post-it® Notes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256866823467017474
Posted on 19/11/2017, 10:08 AM
Rating: G