Tap / click on image to see more RealViewsTM
$36.15
per wood art stamp
 

Viking Pattern Blue Rubber Stamp

Qty:
Wooden Handle
-$1.40
None
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50
+$19.50

Other designs from this category

About Wood Art Stamps

Sold by

Size: 5 cm x 5 cm

Transform any craft project with a personalised maple wood stamp. Leave an impression by uploading a design, image, pattern, or text to make your unique stamp.

  • Available in six sizes
  • Laser engraved on foam cushion
  • Optional wooden handle
  • Optional Colour Box® ink pad is permanent ink for scrapbooking and paper craft projects
  • Additional Colour Box® ink pads in a variety of colours can be found by following this Link
  • Ink pad size: 10.16 cm L x 6.35 cm W x 1.27 cm D
  • Raised pad surface
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating2.9K Total Reviews
2490 total 5-star reviews245 total 4-star reviews65 total 3-star reviews43 total 2-star reviews56 total 1-star reviews
2,899 Reviews
Reviews for similar products
5 out of 5 stars rating
By Casez C.29 October 2021Verified Purchase
Zazzle Reviewer Program
Such a great experience. Right from the creating of the stamp to delivery to my door here in New Zealand. I use the two stamps I purchase all the time to customize our packaging. Amazing I love using the two stamps we purchased
5 out of 5 stars rating
By Stacey W.11 December 2021Verified Purchase
Zazzle Reviewer Program
I'm pleasantly surprised how well this product is made. Very good quality. It is a good weight, clear writing and beautifully made. I have completely underestimated the size stamp I ordered and now need to order the correct size pad. I can't wait.
5 out of 5 stars rating
By Lisa-Maree W.5 March 2023Verified Purchase
Zazzle Reviewer Program
I am so in love with this stamp! It’s perfect in every way and extremely elegant and beautiful. Fabulous craftsmanship and execution!!! Would highly recommend this artist to make the most top quality products. Design was impeccable with the delicate lettering perfect! Making such a fantastic stamp

Tags

Wood Art Stamps
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Posted on 20/11/2017, 11:38 AM
Rating: G