Tap / click on image to see more RealViewsTM
$41.40
per stocking
 

Viking Pattern Blue Small Christmas Stocking

Qty:
Small
Brushed Poly
Red Back Panel

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking 23 cm x 41 cm (9" x 16")

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalised stocking decorated with favourite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 22.8 cm x 40.6 cm
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating434 Total Reviews
353 total 5-star reviews60 total 4-star reviews10 total 3-star reviews6 total 2-star reviews5 total 1-star reviews
434 Reviews
Reviews for similar products
5 out of 5 stars rating
By Pania B.7 December 2020Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Good material. Exactly as expected. Good. Nice and clear design and colours!
5 out of 5 stars rating
By Pania B.18 May 2021Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Cute. My cats loved it, and the treats inside! Purrfect! Clear and colorful.
5 out of 5 stars rating
By M.15 January 2022Verified Purchase
Red Back Panel Christmas Stocking, Faux Linen
Zazzle Reviewer Program
Very happy with this. Made it special for our little man. Nicely done. Looks great.

Tags

Christmas Stockings
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Posted on 18/11/2017, 12:42 PM
Rating: G