Tap / click on image to see more RealViewsTM
$19.50
$1.95 per sheet
 

Viking Pattern Blue Stationery

Qty:
Thin Matte Paper

4.1pt thickness / 80 lb weight
Crisp white, matte finish

+$0.24
+$0.24
+$0.24

Other designs from this category

About Stationery

Sold by

Size: 14 cm x 21.6 cm

The paper you write on can say just as much as the words written on it, so make your notes stand out with stationery for your home and office. Choose from 5 different paper types and write letters and business correspondence that will make everyone take notice!

  • 21.6 cm l x 14 cm w (portrait) or 14 cm l x 21.6 cm w (landscape)
  • Choice of five paper types
  • High quality, full-colour, full-bleed printing
  • Creator Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 14 cm x 21.6 cm. For best results please add 1.5 mm bleed

Paper Type: Thin Matte Paper

Your business and personal mailings will have a crisp professional look on this matte. Contains 50% recycled content (10% post-consumer and 40% pre-consumer waste).

About This Design

Viking Pattern Blue Stationery

Viking Pattern Blue Stationery

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating397 Total Reviews
327 total 5-star reviews42 total 4-star reviews19 total 3-star reviews4 total 2-star reviews5 total 1-star reviews
397 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.4 December 2018Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
love that I can edit and type what I need on there. great, colours were perfect
5 out of 5 stars rating
By A.4 December 2018Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
quality good, nothing wrong. Colours turned out great
5 out of 5 stars rating
By A.20 November 2017Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
was great, didn't need to change a thing. colours were perfect

Tags

Stationery
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 229486491158181475
Posted on 18/11/2017, 12:08 PM
Rating: G