Tap / click on image to see more RealViewsTM
$61.40
each
 

Viking Pattern Blue Tote Bag

Qty:
  1. Style

  2. Size

Other designs from this category

About Totes

Sold by

Style: All-Over-Print Tote Bag, Medium

The classic tote with a modern twist: all-over-print allows for 100% customisation, bringing the basic tote to the next level. Your next shopping trip just got a little more earth-friendly and a lot more stylish!

  • Dimensions: 40.6 cm l x 40.6 cm w; Strap: 71.1 cm l
  • Material:
    • Exterior: 100% sturdy brushed polyester
    • Interior: 100% polyester nonwoven laminate
  • 100% cotton web handles
  • Printed then sewn for edge-to-edge designs
  • Black laminated lining for extra support
  • Spot or dry clean only
  • Made in the USA

About This Design

Viking Pattern Blue Tote Bag

Viking Pattern Blue Tote Bag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating2.3K Total Reviews
2099 total 5-star reviews115 total 4-star reviews18 total 3-star reviews7 total 2-star reviews19 total 1-star reviews
2,258 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Moana F.14 May 2021Verified Purchase
Zazzle Reviewer Program
LOVED IT USED IT AND GREAT. GOOD NEED TO GET MORE LATER PLEASE
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diane G.7 August 2023Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Zazzle Reviewer Program
It was a really cute tote bag! Really well made and a talking point! Was a gift for a dash hound owner who loved it! Great looked fabulous!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kim C.26 December 2020Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Zazzle Reviewer Program
I was thrilled with this item. It was made exactly to my requirements. Not only was it well made but it arrived well packaged and was easily tracked and arrived within the time frame specified. I would recommend this company to my friends and would not hesitate to use again in the future. Printing was clear and exactly how I requested. I'm very pleased with this product

Tags

Totes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256198166661462734
Posted on 28/07/2017, 10:07 PM
Rating: G