Tap / click on image to see more RealViewsTM
$41.75
per mug
 

Viking Pattern Blue Two-Tone Coffee Mug

Qty:
Two-Tone Mug
-$2.35
+$2.30
+$9.30
+$11.60
+$16.25
+$20.90
Black

Other designs from this category

About Mugs

Sold by

Style: Two-Tone Mug

Add a pop of colour to your morning coffee! The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the inside is vividly glazed in rich colour. Give this fun gift to a friend, or add some zest to your dinnerware collection.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Two-Tone Coffee Mug

Viking Pattern Blue Two-Tone Coffee Mug

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating21.9K Total Reviews
19314 total 5-star reviews1842 total 4-star reviews331 total 3-star reviews142 total 2-star reviews225 total 1-star reviews
21,854 Reviews
Reviews for similar products
5 out of 5 stars rating
By L.22 April 2024Verified Purchase
Two-Tone Mug, 325 ml
It arrived safely and on time. The product is of great quality and I am more than pleased with my purchase. The coffee mug is beautifully painted in the two-tone hunter green, with the NZ Fantail bird depicted on both front and back and looks amazing. It will make an excellent present, which the purchase was intended for.
5 out of 5 stars rating
By Andy M.21 April 2020Verified Purchase
Two-Tone Mug, 325 ml
Creator Review
Very well made, excellent print quality, very clear and colours strong. Finish and glazing great. Works equally as well with tea or coffee. Very pleased with how the graphics turned out. Been able to design your own mug is fantastic. Viewers feedback is excellent
5 out of 5 stars rating
By J.27 December 2023Verified Purchase
Two-Tone Mug, 325 ml
Zazzle Reviewer Program
Brilliant! My granddaughter was so thrilled. It arrived well packaged and in good time. Price was good too. Perfect. Bright, vibrant colors, looks hard wearing too.

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168824120322378292
Posted on 19/12/2016, 7:15 PM
Rating: G