Tap / click on image to see more RealViewsTM
$17.30
per set of 6 labels
 

Viking Pattern Blue Wine Label

Qty:
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
-$2.85
-$5.80
+$11.55
+$11.55
+$11.55
+$11.55
+$11.55

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating1.9K Total Reviews
1727 total 5-star reviews82 total 4-star reviews17 total 3-star reviews9 total 2-star reviews33 total 1-star reviews
1,868 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.21 December 2021Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Great quality labels - was impressed with how easy it was to create and really happy with the result. Perfect - the printed labels stand out amazingly
5 out of 5 stars rating
By Erika C.3 November 2021Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
So many to choose from, everything was perfect, ease of website, shipping and quality of product. Great Quality and perfect sizing.
5 out of 5 stars rating
By T.18 October 2020Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Labels arrived quickly and look great. Was so simple to put together and get ordered. Great for any occasion with being able to customise the labels. Definitely recommend. Printing was perfect. Clear as

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Posted on 18/11/2017, 11:50 AM
Rating: G