Tap / click on image to see more RealViewsTM
$17.30
per set of 6 labels
 

Viking Pattern Blue Wine Label

Qty:
  1. Style

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating1.9K Total Reviews
1779 total 5-star reviews81 total 4-star reviews21 total 3-star reviews12 total 2-star reviews43 total 1-star reviews
1,936 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Scott21 December 2021Verified Purchase
Wine Bottle Label
Zazzle Reviewer Program
Great quality labels - was impressed with how easy it was to create and really happy with the result. Perfect - the printed labels stand out amazingly
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous13 June 2026Verified Purchase
Mini Wine Bottle Label
Super easy to order and delivered quickly. Great product. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erika C.3 November 2021Verified Purchase
Wine Bottle Label
Zazzle Reviewer Program
So many to choose from, everything was perfect, ease of website, shipping and quality of product. Great Quality and perfect sizing.

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Posted on 18/11/2017, 11:50 AM
Rating: G