Tap / click on image to see more RealViewsTM
$5.65
per program
 

Vintage Crackled Pink Cherry Blossoms Program Programme

Qty:
Squared
+$0.35
+$0.45
+$0.45
+$0.45
+$0.45
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$3.15
+$1.30
+$1.30
+$1.30
-$0.35

Other designs from this category

About Flat Programs

Sold by

Size: 12.7 cm x 17.8 cm

Memorialise your ceremony with a beautiful program designed to highlight your occasion.

  • Dimensions: 12.7 cm x 17.78 cm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Vintage Crackled Pink Cherry Blossoms Program Programme

Vintage Crackled Pink Cherry Blossoms Program Programme

Aged to perfection pink flowering cherry blossoms on a vintage crackled background. A chic and whimsical motif perfect for weddings, anniversaries and other occasions. You can customise it to whatever your needs may be for your event. RSVP cards and other products are available in my shop. Other colours schemes are available upon request.

Customer Reviews

4.8 out of 5 stars rating889 Total Reviews
777 total 5-star reviews91 total 4-star reviews12 total 3-star reviews4 total 2-star reviews5 total 1-star reviews
889 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Melanie Y.29 December 2016Verified Purchase
Flat Programme, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
We thought the product turned out just how we wanted it, we are really happy with it. the printing is awesome, we are really happy with it
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amanda T.28 December 2020Verified Purchase
Flat Programme, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
Product came fast and was very easy to change the wording to match my needs. Worth paying and little bit extra for the matte finish. The ink wasn’t smeared at all, the papers were wrapped in plastic for safe keeping and cleanliness. All came with envelopes
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sherrie P.17 November 2022Verified Purchase
Flat Programme, Size: 10.2 cm x 23.5 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
The paper was great the colors were good and looked rich! It was so convenient to them done. The printing was perfect and convenient
from zazzle.com (US)

Tags

Flat Programs
wedding programfloralelegantcherry blossomspinkweddingvintagecrackledagedpink and brown
All Products
wedding programfloralelegantcherry blossomspinkweddingvintagecrackledagedpink and brown

Other Info

Product ID: 161492582737369943
Posted on 20/03/2012, 2:48 PM
Rating: G