Tap / click on image to see more RealViewsTM
$17.85
$5.95 per sheet of tissue paper
 

Vintage French Poster Cats Girl Milk Tissue Paper

Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Tissue Paper

Sold by

Size: 35.56 cm x 50.8 cm

Customise your own creative tissue paper for gift wrapping. You can add something simple like the recipients’ name, or get fancy by adding a cool design, photo, image, or artwork for a one-of-a-kind look. Add pizazz to any present!

  • Please note that this size tissue arrives folded
  • Dimensions: 35.56 cm L x 50.8 cm W unfolded (35.56 cm L x 25.4 cm W folded)
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Vintage French Poster Cats Girl Milk Tissue Paper

Vintage French Poster Cats Girl Milk Tissue Paper

Darling French vintage Lait Pur de la Vingeanne Sterilise Art Print by Théophile Alexandre Steinlen, with Cats at the foot of a Girl drinking Milk, is on this Tissue Paper. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating2.8K Total Reviews
2538 total 5-star reviews147 total 4-star reviews45 total 3-star reviews23 total 2-star reviews41 total 1-star reviews
2,794 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.2 September 2025Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Love it , quality is great and designs beautiful. Its a shame the sizing and prices changed but won't stop me buying more haha.
5 out of 5 stars rating
By Wendy C.10 June 2025Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
So pleased I finally got my order, 1st one went missing in the post. But I Absolutely adore this paper, so whimsical ❤️ thanks it’s so beautiful! .
5 out of 5 stars rating
By DM S.19 June 2022Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
It looks stunning on my bedside dresser door. Very bold and colourful

Tags

Tissue Paper
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets
All Products
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets

Other Info

Product ID: 256007565250066876
Posted on 7/09/2019, 6:08 AM
Rating: G