Tap / click on image to see more RealViewsTM
$3.40
per postcard
 

Vintage Italy Italian Map Travel Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.35

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Vintage Italy Italian Map Travel Postcard

Vintage Italy Italian Map Travel Postcard

Anyone would love to receive this vintage Italian travel postcard featuring a map of Italy with flowers and bees! Your recipient will appreciate the floral and architecture motif of this postcard!

Customer Reviews

4.9 out of 5 stars rating15.7K Total Reviews
14277 total 5-star reviews1002 total 4-star reviews197 total 3-star reviews67 total 2-star reviews113 total 1-star reviews
15,656 Reviews
Reviews for similar products
5 out of 5 stars rating
By Heather D.20 September 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
It was exactly like the pic on Zazzle. Size was good to write on the back. Image was great. Lovely colours and clear
5 out of 5 stars rating
By Dash K.23 January 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
I was pleased with the excellent quality of the calendar and the high quality of the card stock used. I will definitely order these postcards again. The printing was excellent. I was so pleased!
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Much better quality than you can buy in the shops and they are exactly on the subject I love and adore too.

Tags

Postcards
italyvintagemaptravelitalianfloralflowersbeesarchitecturehoneycomb
All Products
italyvintagemaptravelitalianfloralflowersbeesarchitecturehoneycomb

Other Info

Product ID: 256145502734538168
Posted on 21/09/2021, 4:31 AM
Rating: G