Tap / click on image to see more RealViewsTM
$54.35
per poster
 

Vintage Travel Poster London

Qty:
Choose Your Format
50.8 cm x 60.96 cm
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favorite quotes, art, or designs printed on our custom Giclee posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-color spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 60”
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Vintage Travel Poster London

Vintage Travel Poster London

Vintage Travel Poster London Vintage style travel poster for London, England , public domain , skyline, cityscape

Customer Reviews

4.8 out of 5 stars rating14.2K Total Reviews
12225 total 5-star reviews1337 total 4-star reviews250 total 3-star reviews141 total 2-star reviews251 total 1-star reviews
14,204 Reviews
Reviews for similar products
5 out of 5 stars rating
By Donna Y.2 June 2022Verified Purchase
Print, Size: 60.96cm x 91.44cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
I originally ordered this print in a larger size but was not pleased with the clarity of it. When I contacted Zazzle, they responded really quickly and were very helpful. I was able to reorder the print in a smaller size and it was shipped to me within a couple of weeks. The print was packaged well to ensure there was no damage during transit (Eco friendly, too!), and I am really pleased with it. I am so grateful to the customer service team for the professional way they handled my order. I had this printed on matt finish card and I was really pleased with the quality. The colours were rich and the image sharp.
5 out of 5 stars rating
By Mignon G.22 December 2021Verified Purchase
Print, Size: 41.91cm x 64.77cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Very happy with this product. No complaints.
5 out of 5 stars rating
By Vincent H.5 November 2024Verified Purchase
Print, Size: 121.92cm x 81.28cm, Media: Value Poster Paper (Semi-Gloss)
Arrived very fast, even three days early. Havent opened as i will wgive to my framer next week. But the team were amazing to deal with and i highly recomend based on that alone! Oh, and im from NZ. .

Tags

Posters
englandpublic domainskylinecityscapevintagetravelposterlondonstylefor
All Products
englandpublic domainskylinecityscapevintagetravelposterlondonstylefor

Other Info

Product ID: 256404728822493100
Posted on 19/07/2024, 7:09 AM
Rating: G