Tap / click on image to see more RealViewsTM
$89.75
per wallpaper
 

wallpaper

Qty:

About Wallpapers

Sold by

Style: Smooth Vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

wallpaper

wallpaper

Transform Your Space with Peel and Stick Wallpaper Elevate your living spaces effortlessly with our Peel and Stick Wallpaper. This innovative product features a high-quality matte finish and a simple peel-and-stick application, allowing you to transform any room with ease. Choose from textured vinyl or smooth vinyl and six different sizes, including a handy swatch to test the application. Whether you’re looking to accent a small wall or give an entire room a makeover, our wallpaper is the perfect fit. Key Features: Easy Maintenance: The wallpaper's smooth surface ensures easy cleaning and maintenance, ideal for busy households or high-traffic areas. Residue-free Removal: When it's time for a change, our wallpaper can be removed effortlessly without leaving any residue or damaging your walls, ensuring a seamless transition. Versatile Design Options: Explore a wide range of captivating designs, patterns, and colours to match your personal style and enhance any room's ambiance. DIY-Friendly: Designed for easy DIY installation, our Peel and Stick Wallpaper requires no professional skills or tools, saving you time and money. Experience the convenience and beauty of our Peel and Stick Wallpaper. Transform your home with style and ease today!

Customer Reviews

4.3 out of 5 stars rating11 Total Reviews
8 total 5-star reviews0 total 4-star reviews2 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
11 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tiffany A.27 March 2026Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
Better than anticipated. Just the right pattern and with an installer from Thumbtack, looks beyond seamless. A dreamy pattern I will forever be grateful for. .
from zazzle.com (US)
5 out of 5 stars rating
By Awake A.12 April 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
This is my second terrific, custom-designed Zazzle purchase. My custom-designed wallpaper is fabulous!! It arrived super well-packaged, and on time. It is really beautiful and of very high quality. I think this designer is extremely talented. She certainly knows how to follow instructions for a perfect custom design! You would do well to buy anything from Zazzle and, in particular, this designer. Excellent experience!!
from zazzle.com (US)
5 out of 5 stars rating
By Charles K.15 August 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
from zazzle.com (US)

Tags

Wallpapers
wallpaperpeelstickmattevinyltexturedsmootheasydiymaintenance
All Products
wallpaperpeelstickmattevinyltexturedsmootheasydiymaintenance

Other Info

Product ID: 256100327345899790
Posted on 6/08/2024, 9:48 AM
Rating: G