Tap / click on image to see more RealViewsTM
$12.85
per sticker
 

When Pigs Fly with Googles Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x10.16 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 10.2 cm L x 4.12.7 cm W
  • Design Area: 10.2 cm L x 10.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

When Pigs Fly with Googles Sticker

When Pigs Fly with Googles Sticker

Sticker of a flying Pig wearing googles

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
914 total 5-star reviews69 total 4-star reviews27 total 3-star reviews29 total 2-star reviews83 total 1-star reviews
1,122 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5.0 out of 5 stars rating
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.16 August 2023Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.

Tags

Custom-Cut Vinyl Stickers
flyingpigpinkwhenpigsgiftideafanloversticker
All Products
flyingpigpinkwhenpigsgiftideafanloversticker

Other Info

Product ID: 256773652565804315
Posted on 16/02/2024, 12:04 PM
Rating: G